################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 18:15:14 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/A2M_A.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ayoa.pdb # 2: 1edya.pdb # # Length: 139 # Identity: 84/139 ( 60.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 84/139 ( 60.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/139 ( 10.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ayoa.pdb 1 EFPFALEVQTLP--QTCDGPKAH---TSFQISLSVSYIGSRPASNMAIVDVKMVSGFIPL 55 1edya.pdb 1 EAPFTLKVNTLPLNFDKA-----EHHRKFQIHINVSYIGERPNSNMVIVDVKMVSGFIPV 55 E PF L V TLP FQI VSYIG RP SNM IVDVKMVSGFIP 1ayoa.pdb 56 KPTVKMLER-SNVSRTEVSNNHVLIYLDKVTNETLTLTFTVLQDIPVRDLKPAIVKVYDY 114 1edya.pdb 56 KPSVKKLQDQSNIQRTEVNTNHVLIYIEKLTNQTMGFSFAVEQDIPVKNLKPAPVKVYDY 115 KP VK L SN RTEV NHVLIY K TN T F V QDIPV LKPA VKVYDY 1ayoa.pdb 115 YETDEFAVAEYSAPCS--- 130 1edya.pdb 116 YETDEFAIEEYSAPFSSDS 134 YETDEFA EYSAP S #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################