################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 00:24:33 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/ALBUMIN.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1bj51.pdb # 2: 1bj52.pdb # 3: 1bj53.pdb # # Length: 212 # Identity: 16/212 ( 7.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 73/212 ( 34.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 33/212 ( 15.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bj51.pdb 1 HKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVAD----ES 56 1bj52.pdb 1 ---LKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHG------ 51 1bj53.pdb 1 ---QNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAK-- 55 c f lGE Fka l r q pq f vklv ltkv Cc 1bj51.pdb 57 AENCDKSLHTLFGDKLCTVATLRE--TYGEMADCCAKQEPERNECFLQHK-DDN--PNLP 111 1bj52.pdb 52 DLLECADDRADLAKYICEN--QDS--ISSKLKECCEKPLLEKSHCIAEVE-NDEMPADLP 106 1bj53.pdb 56 RMPCAEDYLSVVLNQLCVL--HEKTPVSDRVTKCCTESLVNRRPCFSALEVDET--YVPK 111 c d lC s CC k l er Cf e dd lp 1bj51.pdb 112 RLVRPE---VDVMCTAFHD---NEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTE 165 1bj52.pdb 107 SLA-ADFVESKDVCKNYAE---AKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEK 162 1bj53.pdb 112 EFNAETFTF---HADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEK 168 l c fl LyE arrhP Ll ak y a ek 1bj51.pdb 166 CCQAADKAAC--LLPKLDELRDEGKASSAKQR 195 1bj52.pdb 163 CCAAADPH--ECYAKVFDEFKPLVEEPQNLIK 192 1bj53.pdb 169 CCKADDKETC--FAEEGKKLVAASQAALG--- 195 CC AaDk a del a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################