################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 18:20:25 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/AlaDh_PNT_D2.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1f8ga.pdb # 2: 1pjca.pdb # # Length: 195 # Identity: 45/195 ( 23.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/195 ( 23.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 48/195 ( 24.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1f8ga.pdb 1 AGYRAVIDGAYEFA-------RAFPTAAG---TVPPARVLVFGVGVAGLQAIATAKRLGA 50 1pjca.pdb 1 AGRLSVQFGARFLERQQGGRGVLLG----GVPGVKPGKVVILGGGVVGTEAAKMAVGLGA 56 AG V GA V P V G GV G A A LGA 1f8ga.pdb 51 VV-ATDVRAATKEQVESL-G--GKFITVDDEATAETAGGYAKEGEEFRKKQAEAVLKELV 106 1pjca.pdb 57 QVQIFDINVERLSYLETLFGSRVELLYS----------------------NSAEIETAVA 94 V D E L G 1f8ga.pdb 107 KTDIAITTALIPGKPAPVLITEEVT---KKPGSVIIDLAVEAGGNCPLSEPG----KIVV 159 1pjca.pdb 95 EADLLIGAVLVPGRRAPILVPASL-VEQMRTGSVIVDVAVDQGGCVETLHPTSHTQPTYE 153 D I L PG AP L GSVI D AV GG P 1f8ga.pdb 160 KHGVKIVGHTNVPSR 174 1pjca.pdb 154 VFGVVHYGVPNMPGA 168 GV G N P #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################