################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 18:20:47 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Ald_Xan_dh_1.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1alo.pdb # 2: 1qj2a.pdb # # Length: 197 # Identity: 61/197 ( 31.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/197 ( 31.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 42/197 ( 21.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1alo.pdb 1 MIQKVITVNGIEQNLFVDAEALLSDVLRQQLGLTGVKVGCEQGQCGACSVILDGKVVRAC 60 1qj2a.pdb 1 KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSC 60 T NG V LL R Q LTG GC CGAC V LDG V C 1alo.pdb 61 VTKMKRVADGAQITTIEGVGQP---ENLHPLQKAWVLHGGAQCGFCSPGFIVSAKGLLDT 117 1qj2a.pdb 61 TMFAVQANG-ASITTIEGMA--APDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQE 117 A ITTIEG L LQ G QCG C PG I LL 1alo.pdb 118 NADPSREDVRDWFQKHRNACRCTGYKPLVDAVMDAAAVINGKKPETDLEFKMPADGRIWG 177 1qj2a.pdb 118 NPSPTEAEIRFGIG--GNLCRCTGYQNIVKAIQYAAAKINGVP----------------- 158 N P R N CRCTGY V A AAA ING 1alo.pdb 178 SKYPRPTAVAKVTGTL- 193 1qj2a.pdb 159 ----------------F 159 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################