################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 18:43:33 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Apocytochrome_F.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1cfma.pdb # 2: 1hcz.pdb # # Length: 252 # Identity: 175/252 ( 69.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 175/252 ( 69.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/252 ( 1.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1cfma.pdb 1 YPVFAQQNYANPREANGRIVCANCHLAQKAVEIEVPQAVLPDTVFEAVIELPYDKQVKQV 60 1hcz.pdb 1 YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQV 60 YP FAQQNY NPREA GRIVCANCHLA K V IEVPQAVLPDTVFEAV PYD Q KQV 1cfma.pdb 61 LANGKKGDLNVGMVLILPEGFELAPPDRVPAEIKEKVGNLYYQPYSPEQKNILVVGPVPG 120 1hcz.pdb 61 LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG 120 LANGKKG LNVG VLILPEGFELAPPDR E KEK GNL Q Y P KNILV GPVPG 1cfma.pdb 121 KKYSEMVVPILSPDPAKNKNVSYLKYPIYFGGNRGRGQVYPDGKKSNNTIYNASAAGKIV 180 1hcz.pdb 121 QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS 180 KYSE PIL PDPA NK V LKYPIY GGNRGRGQ YPDG KSNNT YNA A G I 1cfma.pdb 181 AITALSEKKGGFEVSIEK-ANGEVVVDKIPAGPDLIVKEGQTVQADQPLTNNPNVGGFGQ 239 1hcz.pdb 181 KILRKE--KGGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQ 238 I KGG E I N V D IP G L V EG DQPLT NPNVGGFGQ 1cfma.pdb 240 AETEIVLQNPAR 251 1hcz.pdb 239 GDAEIVLQDPLR 250 EIVLQ P R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################