################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 01:02:58 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Band_41_M.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1ef1a.pdb # 2: 1gc7a.pdb # 3: 1gg3a.pdb # # Length: 115 # Identity: 28/115 ( 24.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 93/115 ( 80.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/115 ( 12.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ef1a.pdb 1 -DVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGY 59 1gc7a.pdb 1 -DVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGY 59 1gg3a.pdb 1 P-DPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDY 59 vseeLiqdITqrlffLQvke Ilnd iyCppeTavLLaSYavQskyGDynkE Hk gY 1ef1a.pdb 60 LAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRG-LREDAVLEYLKIAQDL--- 110 1gc7a.pdb 60 LANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDL--- 111 1gg3a.pdb 60 VSDFKLAPN-------Q-TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMY 106 la dkLlPq l k qwEEriq wHeehRg lreda lEyLkiAqdL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################