################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 01:03:13 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Band_41_N.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1ef1a.pdb # 2: 1gc7a.pdb # 3: 1gg3a.pdb # # Length: 92 # Identity: 16/ 92 ( 17.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 64/ 92 ( 69.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 92 ( 17.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ef1a.pdb 1 ----TISVRVT-TDAELEFAIQPNTT-GKQLFDQVVKTIGLREVWFF-GLQYQDTKGFST 53 1gc7a.pdb 1 MPKPINVRVTT-MDAELEFAIQPNTT-GKQLFDQVVKTVGLREVWFF-GLQYVDSKGYST 57 1gg3a.pdb 1 ----MHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNA--TSKT 54 v t DaelEfaiqpntt gkqLfdqvvkt gLrEvwFf glqy d g sT 1ef1a.pdb 54 WLKLNKKVTAQDVRKE-SP-LLFKFRAKFYPE 83 1gc7a.pdb 58 WLKLNKKVTQQDVKKE-NP-LQFKFRAKFFPE 87 1gg3a.pdb 55 WLDSAKEIKKQV----RGVPWNFTFNVKFYP- 81 WLklnKkvt Qd p l FkFraKFyP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################