################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 01:33:51 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/COX2.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1ar1b.pdb # 2: 1cyx.pdb # 3: 2occb.pdb # # Length: 301 # Identity: 21/301 ( 7.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 70/301 ( 23.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 188/301 ( 62.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ar1b.pdb 1 QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRF 60 1cyx.pdb ------------------------------------------------------------ 2occb.pdb 1 -----------MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTT- 48 1ar1b.pdb 61 NRRANPVPARFT--HNTPIEVIWTLVPVLILVAIGAFSLPILFRSQE-MPNDP-DLVIKA 116 1cyx.pdb 1 -----------------------------------------------------KPITIEV 7 2occb.pdb 49 -----KLTHTSTMD-AQEVETIWTILPAIILILIALPSLRILYMM-DE-INNP-SLTVKT 99 ltik 1ar1b.pdb 117 IGHQWYWSYEYPN-DGVAFDALMLEKEALA---DAGYSEDEYLLATDNPVVVPVGKKVLV 172 1cyx.pdb 8 VSMDWKWFFIYPE-QGIATVN---------------------------EIAFPANTPVYF 39 2occb.pdb 100 MGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGE-------LRLLEVDNRVVLPMEMTIRM 152 ghqWyWsyeYp g afd vv P v 1ar1b.pdb 173 QVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVK 232 1cyx.pdb 40 KVTSNSVMHSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGICAEICGPGHSGMKFKAI 99 2occb.pdb 153 LVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLE 212 Vts dV Hsw iP lg k dA pGr ql l pG Y GqCsEiCG nHs Mpiv 1ar1b.pdb 233 AV-SQEKYEAWLAGAKEEF-----------AA---------------------------- 252 1cyx.pdb 100 ATPDRAAFDQWVAKAKQS-PNTMSDMAAFEK-LAAPSEYNQVEYFSNVKPDLFADVINKF 157 2occb.pdb 213 LV-PLKYFEKWSASML-------------------------------------------- 227 av fe W A ak 1ar1b.pdb - 1cyx.pdb 158 M 158 2occb.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################