################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 01:51:32 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/DNA_pol3_beta.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 2pola1.pdb # 2: 2pola2.pdb # 3: 2pola3.pdb # # Length: 139 # Identity: 2/139 ( 1.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/139 ( 22.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 34/139 ( 24.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 2pola1.pdb 1 ---------MKFTVEREHLLKPLQQVSGPLGGR-PTLPILGNLLLQVADGTLSLTGTDLE 50 2pola2.pdb 1 ------QSEVEFTLPQATMKRLIEATQFSMAHQ-DVRYYLNGMLFETEGEELRTVATDGH 53 2pola3.pdb 1 RRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKF------RGVRLYVSENQLKITANNPE 54 ft lk g ll v L tatd e 2pola1.pdb 51 -MEMVARVALVQPHEPGATTVPARKFFDICRGLP-EGAEIAVQLEG--ERMLV-R-S-GR 103 2pola2.pdb 54 -RLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGS--NNIRA-H-V-GD 107 2pola3.pdb 55 QEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC--ENVRMMLTDSVSSVQIEDAASQS 112 eav qs vp v d r L rvql g 2pola1.pdb 104 SRFSLSTLPAADFPNLDDW 122 2pola2.pdb 108 FIFTSKLVDGR---FPDY- 122 2pola3.pdb 113 AAYVVMPMRL--------- 122 f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################