################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 01:59:52 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/E2_C.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1a7ge.pdb # 2: 1by9.pdb # 3: 2bopa.pdb # # Length: 90 # Identity: 20/ 90 ( 22.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/ 90 ( 62.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 90 ( 21.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1a7ge.pdb 1 ATTPIIHLKGDANILKCLRYRL-SKYKQLYEQVSSTWHWTC-----TDGKHKNAIVTLTY 54 1by9.pdb 1 -TTPIVHLKGDANTLKCLRYRF-KKHCTLYTAVSSTWHWT-------------AIVTLTY 45 2bopa.pdb 1 --SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQG---QAQILITF 55 tpi hlkGdAN lKClRyR kkh lYe vssTWhwt AivtlTy 1a7ge.pdb 55 ISTSQRDDFLNTVVIPNTVSVSTGYMTI-- 82 1by9.pdb 46 DSEWQRDQFLSQVKIPKTITVSTGFMS--- 72 2bopa.pdb 56 GSPSQRQDFLKHVPLPPGMNISGFTASLDF 85 S sQRddFL V iP t vStg ms #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################