################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 19:58:05 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/FHA.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1g6ga.pdb # 2: 1qu5a.pdb # # Length: 198 # Identity: 23/198 ( 11.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/198 ( 11.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 87/198 ( 43.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1g6ga.pdb 1 G-------------------------ENIVCRVICTT-GQ-IPIRDLSADISQVLKEKRS 33 1qu5a.pdb 1 -EAETREQKLLHSNNTENVKSSKKKGNGRFLTLKPLPDSIIQESLEIQQ----------- 48 1g6ga.pdb 34 -IKKVWTFGRNPACDYHLGNISRLSNKHFQILLGE---------------DGNLLLNDIS 77 1qu5a.pdb 49 GV-NPFFIGRSEDCNCKIE-DNRLSRVHCFIFKKRHAVGKSMYESPAQGLD-DIWYCHTG 105 GR C RLS H I D 1g6ga.pdb 78 TNGTWLNGQKVEKNSNQLLSQGDEITVGVG--VESDILSLVIFIND-------------- 121 1qu5a.pdb 106 TNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNN-KFVIGFKVEINDTTGLFNEGLGMLQE 164 TN LN LL GDEI IND 1g6ga.pdb 122 ------------KFKQCL 127 1qu5a.pdb 165 QRVVLKQTAEEKDLVKKL 182 L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################