################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 02:35:51 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/HMA.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1cpza.pdb # 2: 2aw0.pdb # 3: 2hqi.pdb # # Length: 76 # Identity: 11/ 76 ( 14.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 76 ( 46.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 76 ( 10.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1cpza.pdb 1 ------AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEI 54 2aw0.pdb 1 LTQ---ETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETL 57 2hqi.pdb 1 ---ATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKL 57 v GMtCn Cv ie a sk GVkkv V l k avV fD s l 1cpza.pdb 55 CQAINELGYQAEVI-- 68 2aw0.pdb 58 RGAIEDMGFDATLSD- 72 2hqi.pdb 58 TKATADAGYPSSVK-Q 72 Ai d Gy a v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################