################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:44:37 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/INTERFERON_A_B_D.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1au1a.pdb # 2: 1itf.pdb # # Length: 187 # Identity: 50/187 ( 26.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/187 ( 26.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 43/187 ( 23.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1au1a.pdb 1 MSYNLLGFLQ-------RSSNFQCQKLLWQLNG-RLEYCLKDRMNFD-IPEEIKQLQQFQ 51 1itf.pdb 1 ----------CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQ--FQ 48 LL Q L CLKDR F EE FQ 1au1a.pdb 52 KEDAALTIYEMLQNIFAIFRQDSSST----GWNETIVENLLANVYHQINHLKTVLEEK-- 105 1itf.pdb 49 KAETIPVLHEMIQQIFNLFSTK----DSSAAWDETLLDKFYTELYQQLNDLEACVIQGVG 104 K EM Q IF F W ET Y Q N L 1au1a.pdb 106 LEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLR 165 1itf.pdb 105 VTETPLM--KEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQE--- 159 K S L Y RI YLK K YS CAW VR EI R F L 1au1a.pdb 166 N------ 166 1itf.pdb 160 -SLRSKE 165 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################