################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 21:40:26 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/NTP_transf_2.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1f5aa.pdb # 2: 1fa0a.pdb # # Length: 349 # Identity: 164/349 ( 47.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 164/349 ( 47.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/349 ( 2.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1f5aa.pdb 1 ----YGITSPISLAAPKETDCLLTQKLVETLKPFGVFEEEEELQRRILILGKLNNLVKEW 56 1fa0a.pdb 1 SQKVFGITGPVSTVGATAAENKLNDSLIQELKKEGSFETEQETANRVQVLKILQELAQRF 60 GIT P S L L LK G FE E E R L L L 1f5aa.pdb 57 IREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYD 116 1fa0a.pdb 61 VYEVSKKKNMSDGMARDAGGKIFTYGSYRLGVHGPGSDIDTLVVVPKHVTREDFFTVFDS 120 E S KN GGKIFT GSYRLGVH G DID L V P HV R DFFT F 1f5aa.pdb 117 KLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDI 176 1fa0a.pdb 121 LLRERKELDEIAPVPDAFVPIIKIKFSGISIDLICARLDQPQVPLSLTLSDKNLLRNLDE 180 L E V AFVP IK F GI ID ARL P L L D LL NLD 1f5aa.pdb 177 RCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWA-LVAR 235 1fa0a.pdb 181 KDLRALNGTRVTDEILELVPKPNVFRIALRAIKLWAQRRAVYANIFGFPGGVAWAMLVAR 240 R LNG RVTDEIL LVP FR LRAIKLWA R Y NI GF GGV WA LVAR 1f5aa.pdb 236 TCQLYPNAIASTLVHKFFLVFSKWEWPNPVLLKQPEECNLNLPVWDPRVNPSDRYHL-PI 294 1fa0a.pdb 241 ICQLYPNACSAVILNRFFIILSEWNWPQPVILKPIEDGPLQVRVWNPKIYAQDRSHRMPV 300 CQLYPNA FF S W WP PV LK E L VW P DR H P 1f5aa.pdb 295 ITPAYPQQNSTYNVSVSTR-V-VEEFKQGLAITDEILLSKAEWSKLFEA 341 1fa0a.pdb 301 ITPAYPSMCATHNITESTKKVILQEFVRGVQITNDIFSNKKSWANLFEK 349 ITPAYP T N ST V EF G IT I K W LFE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################