################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 22:24:28 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/PGM_PMM_I.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1kfqa.pdb # 2: 3pmga.pdb # # Length: 206 # Identity: 87/206 ( 42.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 87/206 ( 42.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/206 ( 8.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1kfqa.pdb 1 QQVIPAPRVQVTQPYAGQKPGTSGLRKKVSEAT-QPNYLENFVQSIFNTLRKDELKPKNV 59 3pmga.pdb 1 ----VKIVTVKTKAYPDQKPGTSGLRKRVKVFQSSTNYAENFIQSIISTVEPAQRQE-AT 55 T Y QKPGTSGLRK V NY ENF QSI T 1kfqa.pdb 60 LFVGGDGRYFNRQAIFSIIRLAYANDISEVHVGQAGLMSTPASSHYIRKVNEEVGNCIGG 119 3pmga.pdb 56 LVVGGDGRFYMKEAIQLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIK-----AIGG 110 L VGGDGR AI I R A AN I GQ G STPA S IRK IGG 1kfqa.pdb 120 IILTASHNPGGKEHGDFGIKFNVRTGAPAPEDFTDQIYTHTTKIKEYLTVDYEFEKHINL 179 3pmga.pdb 111 IILTASHN-PGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPD-LK--VDL 166 IILTASHN G GDFGIKFN G PAPE TD I I EY L 1kfqa.pdb 180 DQIGVYKFEGTRLEK-SHFEVKVVDT 204 3pmga.pdb 167 GVLGKQQFDLEN--KFKPFTVEIVDS 190 G F K F V VD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################