################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 09:22:14 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/RGS.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: 1agre.pdb # 2: 1cmza.pdb # 3: 1dk8a.pdb # 4: 1fqia.pdb # # Length: 152 # Identity: 22/152 ( 14.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 42/152 ( 27.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/152 ( 21.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1agre.pdb 1 VS-------QEEVKKWAESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKS 53 1cmza.pdb 1 PS-------PEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEAN 53 1dk8a.pdb 1 --GSASPT--PPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEP 56 1fqia.pdb 1 ---KLVDIPTKRVERWAFNFSELIRDPKGRQSFQHFLRKEFSGENLGFWEACEDLKYGDQ 57 v WA s L G F FL E s en FW aCe k 1agre.pdb 54 ----PSKLSPKAKKIYNEFISV-QATKE-VNLDSCTREETSRNM-L-EPTITCFDEAQKK 105 1cmza.pdb 54 ----QHVVDEKARLIYEDYVSI-LSPKE-VSLDSRVREGINKKM-Q-EPSAHTFDDAQLQ 105 1dk8a.pdb 57 CDSNEEKRLKLARAIYRKYILDNNGIVSR-QTKPATKSFIKGCIMKQLIDPAMFDQAQTE 115 1fqia.pdb 58 ----S-KVKEKAEEIYKLFLAP-GARRW-INIDGK-TDITVKGL-K-HPHRYVLDAAQTH 107 k kA IY d p fD AQ 1agre.pdb 106 IFNLMEKDSYRRFLKSRFYLDLT--------- 128 1cmza.pdb 106 IYTLMHRDSYPRFLSSPTYRALL--------- 128 1dk8a.pdb 116 IQATMEENTYPSFLKSDIYLEYTRTGSESPKV 147 1fqia.pdb 108 IY-L-KKDSYARYLKSPIYKELAKAIEP---- 133 I l dsY rfLkS Y l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################