################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:07:46 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/RNA_pol_K.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1i50f.pdb # 2: 1qkla.pdb # # Length: 133 # Identity: 56/133 ( 42.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/133 ( 42.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 55/133 ( 41.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1i50f.pdb 1 ----------------KAIPK--------------------------DQ-RATTPYMTKY 17 1qkla.pdb 1 MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY 60 Q R TTPYMTKY 1i50f.pdb 18 ERARILGTRALQISMNA-PVFVDLEGETDPLRIAMKELAEKKIPLVIRRY-LPDGSFEDW 75 1qkla.pdb 61 ERARVLGTRALQIAMC-APVMVELEGETDPLLIAMKELKARKIPIIIRRYLP-DGSYEDW 118 ERAR LGTRALQI M PV V LEGETDPL IAMKEL KIP IRRY DGS EDW 1i50f.pdb 76 SVEELIVDL---- 84 1qkla.pdb 119 GVDEL----IITD 127 V EL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################