################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:05:06 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Ribosomal_S8.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1an7a.pdb # 2: 1seia.pdb # # Length: 139 # Identity: 77/139 ( 55.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 77/139 ( 55.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/139 ( 8.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1an7a.pdb 1 -T-DPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLR 58 1seia.pdb 1 VMTDPIADMLTAIRNANMVRHEKLEVPASKIKREIAEILKREGFIRDYEYIEDNKQGILR 60 DPIADMLT IRNA V E VPAS K EI IL REGFI YE LR 1an7a.pdb 59 VYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRG-LGIAILSTSKGVL 117 1seia.pdb 61 IFLKYGP--------NERVITGLKRISKPGLRVYVKAHEVPRVL-NGLGIAILSTSQGVL 111 LKYGP E VI RISKPG RVYV E PRV LGIAILSTS GVL 1an7a.pdb 118 TDREARKLGVGGELICEVW 136 1seia.pdb 112 TDKEARQKGTGGEIIAYVI 130 TD EAR G GGE I V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################