################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:09:41 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/S-AdoMet_syntD2.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1mxb.pdb # 2: 1qm4a.pdb # # Length: 128 # Identity: 58/128 ( 45.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 58/128 ( 45.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/128 ( 7.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1mxb.pdb 1 RADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQ 60 1qm4a.pdb 1 ----EDVGAGDQGLMFGYATDETEECMPLTIVLAHKLNTRMADLRRSGVLPWLRPDSKTQ 56 GAGDQGLMFGYAT ET MP I AH L R A R G LPWLRPD K Q 1mxb.pdb 61 VTFQYDD----GKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFF 116 1qm4a.pdb 57 VTVQYVQDNGAVIPVRVHTIVISVQHNEDITLEAMREALKEQVIKAVVPAKYLDEDTIYH 116 VT QY V V S QH E I EA E IK PA L T 1mxb.pdb 117 INPTGRFV 124 1qm4a.pdb 117 LQPSGRF- 123 P GRF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################