################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:24:51 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Syntaxin.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ez3a.pdb # 2: 1fioa.pdb # # Length: 202 # Identity: 19/202 ( 9.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/202 ( 9.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 90/202 ( 44.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ez3a.pdb 1 RDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPN---PDEKTKEELEELMSDI 57 1fioa.pdb 1 -MHDFVGFMNKISQINRDLDKYDHTINQVDSLHKRLLTEVNEEQA-SHLRHSLDNFVAQA 58 F I DK V H L N L 1ez3a.pdb 58 KKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYR 117 1fioa.pdb 59 TDLQFKLKNEIKSAQRDGIH----------DTNKQAQAENSRQRFLKLIQDYRIVDSNYK 108 K KS Q F Y S Y 1ez3a.pdb 118 ERCKGRI----------------------------------------------------- 124 1fioa.pdb 109 EENKEQAKRQYMIIQPEATEDEVEAAISDVGGQQIFSQALLEAKTALAEVQARHQELLKL 168 E K 1ez3a.pdb ---------------------- 1fioa.pdb 169 EKSMAELTQLFNDMEELVIEQQ 190 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################