################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 00:00:38 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Tymo_coat.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1auya.pdb # 2: 1qjza.pdb # # Length: 181 # Identity: 57/181 ( 31.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 57/181 ( 31.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/181 ( 11.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1auya.pdb 1 ------------------SPLTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRH 42 1qjza.pdb 1 KQASIPAPGSILSQPNTEQSPAIVLPFQFEATTFGTAETAAQVSLQTADPITKLTAPYRH 60 I PFQ E GT A D LT YRH 1auya.pdb 43 ASLESLWVTIHPTLQAPTFPTTVGVCWVPAQSPVTPAQITKTYGGQIFCIGGAIQTLSPL 102 1qjza.pdb 61 AQIVECKAILTPTDLAVSNPLTVYLAWVPANSPATPTQILRVYGGQSFVLGGAISAAKTI 120 A PT A P TV WVPA SP TP QI YGGQ F GGAI 1auya.pdb 103 IVKCPLEMMQPRVKDSIQYLDSPKLLISITAQPTAPPASTCIITVSGTLSMHSPLITDTS 162 1qjza.pdb 121 EVPLNLDSVNRMLKDSVTYTDTPKLLAYSRAPTNPSKIPTASIQISGRIRLSKPMLIAN- 179 V L KDS Y D PKLL A T I SG P 1auya.pdb 163 T 163 1qjza.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################