################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 08:19:05 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/ngf.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: 1b98m.pdb # 2: 1bet.pdb # 3: 1bnda.pdb # 4: 1bndb.pdb # # Length: 123 # Identity: 44/123 ( 35.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/123 ( 51.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/123 ( 17.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1b98m.pdb 1 AGELAVCDAVSGWVT--DRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADGGGP 58 1bet.pdb 1 -GEFSVCDSVSVWVG--DKTTATDIKGKEVTVLAEVNI-NNSVFRQYFFETKCRA----- 51 1bnda.pdb 1 -GQLSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPV-SKGQLKQYFYETKCNP----- 53 1bndb.pdb 1 RGEVSVCDSESLWVT--DKSSAIDIRGHQVTVLGEIKT-QNSPVKQYFYETRCKE----- 52 Ge sVCDs S WVt Dk tA D G VtVL ev s QYF ET C 1b98m.pdb 59 GAG-------GGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLL 111 1bet.pdb 52 ---SNP---VESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQ-AAWRFIRIDTACVCVLS 104 1bnda.pdb 54 ------MGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLT 107 1bndb.pdb 53 ---ARP---VKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALS 106 GCRGiD HWnS C t q yVrALT d gWR IRIDT CVC L 1b98m.pdb 112 SA- 113 1bet.pdb 105 RKA 107 1bnda.pdb 108 IK- 109 1bndb.pdb 107 RK- 108 k #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################