################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 04:25:32 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/tRNA_bind.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1b7yb.pdb # 2: 1fl0a.pdb # 3: 1gd7a.pdb # # Length: 139 # Identity: 8/139 ( 5.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 44/139 ( 31.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 52/139 ( 37.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1b7yb.pdb 1 ----FPIP-R--GVVFARVLEAHPIPG--TRLKRLVLDAG--RTVEVVSGAE-N----AR 44 1fl0a.pdb 1 ------IDVSRLDLRIGCIITARKHPDA-DSLYVEEVDVGEIAPRTVVSGLVNHVPLEQM 53 1gd7a.pdb 1 MTPL--EAFQILDLRVGRVLRAEPHEKARKPSYKLWVDLGPLGVKQSSAQITELYRPEDL 58 i dlr grvl A php ly l vD G vvsg 1b7yb.pdb 45 KGIGVALALPGTELPGLGQK-VGERVIQGVRSFGMALSPRELGVGEYG------GGLLEF 97 1fl0a.pdb 54 QNRMVILLC-----------NLKPAKMRGVLSQAMVMCAS--------S--PEKIEILAP 92 1gd7a.pdb 59 VGRLVVCAV-----------NLGAKRVAGFLSEVLVLGVP--------DEA-GRVVLLAP 98 gr V la lg GvlS mvl lLap 1b7yb.pdb 98 PEDALPPGTPLSEAWP--- 113 1fl0a.pdb 93 PNG-SVPGDRIT----FDA 106 1gd7a.pdb 99 DRE-VPLGGKVF------- 109 p ppG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################